PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr011960.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 442aa    MW: 49001.8 Da    PI: 8.1278
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr011960.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS279.21.2e-85554281374
         GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetseknsseelaalkl.....fsevsPilk 92 
                  l +lLl+cAe v++++  +a++l +    l+s++g+++qR++ yf +AL+++  r ++ ++++  ++++ +  +++e++aal+      f ev P+++
  Pbr011960.1  55 LAHLLLACAEKVAKKQYGCAKKLQNLCDFLSSSSGNSVQRVVYYFSKALQQKTDReTGRNTSQGSESRDVAAVHVEEAMAALSPalmacFLEV-PFFQ 151
                  579*****************9998888999*************************55555665556666665555555555533545557775.**** PP

         GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledl 189
                  ++ ++  qaI+e v++++++H +D+ i  G++ + L+qaLa+R e p  +l++T+vg    +s +++e tg+rLa+fAe+l++pf f++ ++k+++d+
  Pbr011960.1 152 VTEFAGIQAIVENVASSKKIHFVDLAIRTGGHCIVLMQALATRYECPIeMLKVTAVGV---KSGKKIEDTGRRLAQFAEALKLPFTFKIAMVKDIKDI 246
                  *******************************************9666559********...589*************************9******** PP

         GRAS 190 eleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvEr 287
                  +   +++++gEa+aV + l l ++++++ +les    ++k+++sl+P+++vv e ea+hns+ F +rf +al yysa f++l+a + r s  r+ +E+
  Pbr011960.1 247 KEGIFELDTGEAVAVYCPLLLSSTMNQPNCLES----LMKALRSLNPRLMVVNEVEANHNSPIFINRFYKALFYYSAYFECLDACMDRGSALRMELEE 340
                  *************************99999999....************************************************************* PP

         GRAS 288 ellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                   +l+ ei+n+va eg+er++r+ +   Wr+ ++++G+ +++ls +   qa+l+ ++++ ++  ++  + +++v gWk+ p++s+S+W+
  Pbr011960.1 341 TYLSHEIKNIVASEGEERVNRRMKIDGWRSLFGKCGMVEAELSLSSLYQADLIAKQFAcGRSCTMGTNGKCFVVGWKGTPILSLSVWK 428
                  **********************************************************9999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098541.62229407IPR005202Transcription factor GRAS
PfamPF035144.3E-8355428IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 442 aa     Download sequence    Send to blast
MSCASGLSTV EVMRVARERF IQFSSRRYAD DCMADHVLGS TAFGLSDQET KDVGLAHLLL  60
ACAEKVAKKQ YGCAKKLQNL CDFLSSSSGN SVQRVVYYFS KALQQKTDRE TGRNTSQGSE  120
SRDVAAVHVE EAMAALSPAL MACFLEVPFF QVTEFAGIQA IVENVASSKK IHFVDLAIRT  180
GGHCIVLMQA LATRYECPIE MLKVTAVGVK SGKKIEDTGR RLAQFAEALK LPFTFKIAMV  240
KDIKDIKEGI FELDTGEAVA VYCPLLLSST MNQPNCLESL MKALRSLNPR LMVVNEVEAN  300
HNSPIFINRF YKALFYYSAY FECLDACMDR GSALRMELEE TYLSHEIKNI VASEGEERVN  360
RRMKIDGWRS LFGKCGMVEA ELSLSSLYQA DLIAKQFACG RSCTMGTNGK CFVVGWKGTP  420
ILSLSVWKFH AVNVKTFKHL L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-35594288375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009370005.10.0PREDICTED: DELLA protein GAI1-like
TrEMBLM5Y8020.0M5Y802_PRUPE; Uncharacterized protein
STRINGPOPTR_0010s15330.11e-155(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.11e-55RGA-like 1